PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.PJ4IX
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family B3
Protein Properties Length: 293aa    MW: 34477.8 Da    PI: 10.1261
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.PJ4IXgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3474.5e-15351061791
                  E--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
           B3  17 vlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                   +p+kf ++hg+    s  + l+ ++g  W+v+   +k+s+++++ kGWkeF k   L+eg  vvFk++++s+f 
  Araip.PJ4IX  35 KIPNKFSRRHGSA--LSNPVFLKPPDGTLWKVYW-TKKNSDEVWFVKGWKEFTKNYSLNEGHLVVFKYEETSQFD 106
                  79********966..7778***************.5889999**************************9988884 PP

2B344.13.6e-142252922998
                  -..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
           B3  29 kkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                  ++ + k++ l+    r+W+vkl  +++s r  l++GW+ Fv++ngL++ D++vF+l++ ++  ++v+vf+
  Araip.PJ4IX 225 IEDKVKDVALK-VGERQWQVKLLPCRNSAR-RLSGGWSLFVHENGLQAEDVCVFELINMEDSVFKVHVFK 292
                  33333345544.367*******76555555.599**********************97777777999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100173.87E-1416110No hitNo description
SuperFamilySSF1019366.67E-1917120IPR015300DNA-binding pseudobarrel domain
SMARTSM010196.4E-1118113IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.107.3E-2018111IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.40819113IPR003340B3 DNA binding domain
PfamPF023622.1E-1235106IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.6E-17197292IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.31E-14199292IPR015300DNA-binding pseudobarrel domain
SMARTSM010197.0E-6201292IPR003340B3 DNA binding domain
CDDcd100173.89E-13201292No hitNo description
PfamPF023626.0E-12222293IPR003340B3 DNA binding domain
PROSITE profilePS5086311.716239293IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MSSHHHQCQN NIMLHFRFFK AILKTNLQRI IFTQKIPNKF SRRHGSALSN PVFLKPPDGT  60
LWKVYWTKKN SDEVWFVKGW KEFTKNYSLN EGHLVVFKYE ETSQFDVIIL EINDLEIDYS  120
KYETVNRKGK CDQRDEKTVG ILKEIPVKNN DAGKRLTLFS PQPHMKVRGE SSIRRRTSSL  180
NWPKELKAQE IAQKFISYNP FFTLFIKPSY LTEYQVNVPT LKGYIEDKVK DVALKVGERQ  240
WQVKLLPCRN SARRLSGGWS LFVHENGLQA EDVCVFELIN MEDSVFKVHV FKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016169473.10.0PREDICTED: B3 domain-containing transcription factor VRN1-like
TrEMBLG8A2Z59e-95G8A2Z5_MEDTR; B3 domain-containing protein
STRINGGLYMA20G24268.12e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9834369
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.17e-28B3 family protein